Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pichia pastoris Probable endonuclease LCL3(LCL3)

Recombinant Pichia pastoris Probable endonuclease LCL3(LCL3)

SKU:CSB-CF505245EVR

Regular price $1,879.00 USD
Regular price Sale price $1,879.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pichia pastoris (strain GS115 / ATCC 20864) (Yeast)

Uniprot NO.:C4QW04

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAQSNQHVSIYNPKVIVYSIGLTTAILASMSIYRSHFVRFSTSLDVPKTLFRTKHLHGKV TSVGDGDNFHFYHLPGGIFAGWGWIRETPEINKFRKLKNKTIHVRLCGVDAPERSHFGKP SQPYSEEALQWLRQFILGKKVKVKPLSVDQYNRIVGRVFIFRWNGWNDVSEEMLRNGVAI VYENKSSAEFDGMKERYLKVENKAKKKKKGLWGIERGLTPGEYKRLYK

Protein Names:Recommended name: Probable endonuclease LCL3 EC= 3.1.-.-

Gene Names:Name:LCL3 Ordered Locus Names:PAS_chr1-1_0068

Expression Region:1-228

Sequence Info:full length protein

View full details