Gene Bio Systems
Recombinant Pichia pastoris Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)
Recombinant Pichia pastoris Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)
SKU:CSB-CF505241EVR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pichia pastoris (strain GS115 / ATCC 20864) (Yeast)
Uniprot NO.:C4QV79
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASVNYPSSFDKKDEFEDMSILDKIWFRCKQQPLVPIGCLATCVAVALAAKGVRTGDRVN AQKWFRWRVGLQGLTLVALVGGSYIYDRQQVTQRKTDEDLAREKAQHRQDLWIQELERRD QETKRNKERARLARARLEAERSTGILDDEPPK
Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial
Gene Names:Name:AIM31 Ordered Locus Names:PAS_chr1-3_0297
Expression Region:1-152
Sequence Info:full length protein
