Skip to product information
1 of 1

Gene Bio Systems

Recombinant Picea mariana Defender against cell death 1(DAD1)

Recombinant Picea mariana Defender against cell death 1(DAD1)

SKU:CSB-CF006487EVM

Regular price $1,546.00 USD
Regular price Sale price $1,546.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Picea mariana (Black spruce) (Abies mariana)

Uniprot NO.:O65085

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGTSTAKEAHALIASLRSAYSATPTKLKIIDLYVVYAILTAVVQVVYMAIVGSFPFNAFL SGVLSCTGTAVLAVCLRMQVNKENREFKDLPPERAFADFVLCNLVLHLVIMNFLG

Protein Names:Recommended name: Defender against cell death 1 Short name= DAD-1

Gene Names:Name:DAD1 Synonyms:SB66

Expression Region:1-115

Sequence Info:full length protein

View full details