Recombinant Photobacterium profundum  Fumarate reductase subunit D(frdD)

Recombinant Photobacterium profundum Fumarate reductase subunit D(frdD)

CSB-CF753840PIG
Regular price
$1,088.00 USD
Sale price
$1,088.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Photobacterium profundum (Photobacterium sp. (strain SS9))

Uniprot NO.:Q6LM12

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVNLNPKRSDEPVWWGLFGAGGTWFAMLTPVTILVLGIMVPLGILDADAMSYERVSGFVT SFIGALFTIATLALPMWHAMHRLHHGMHDLKFHTGVVGKIACYATAFLVSALAIIFVFMI

Protein Names:Recommended name: Fumarate reductase subunit D

Gene Names:Name:frdD Ordered Locus Names:PBPRA3381

Expression Region:1-120

Sequence Info:full length protein