Skip to product information
1 of 1

Gene Bio Systems

Recombinant Phaeodactylum tricornutum Cytochrome b559 subunit alpha(psbE)

Recombinant Phaeodactylum tricornutum Cytochrome b559 subunit alpha(psbE)

SKU:CSB-CF371382EUF

Regular price $1,511.00 USD
Regular price Sale price $1,511.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Phaeodactylum tricornutum (strain CCAP 1055/1)

Uniprot NO.:A0T0A3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSGGSTGERPFSDIITSVRYWIIHSITIPSLFVSGWLFVSTGLAYDVFGTPRPNEYFTQD RQQIPLVNDRFSAKQELEDLTKGL

Protein Names:Recommended name: Cytochrome b559 subunit alpha Alternative name(s): PSII reaction center subunit V

Gene Names:Name:psbE

Expression Region:1-84

Sequence Info:full length protein

View full details