
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Immunology
Target / Protein: ppiA
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Escherichia coli O157:H7
Delivery time: 3-7 business days
Uniprot ID: P0AFL5
AA Sequence: AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 25-190aa
Protein length: Full Length
MW: 34.1 kDa
Alternative Name(s): PPIase A Alternative name(s): Cyclophilin A Rotamase A
Relevance: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).
Reference: "Complete genome sequence of enterohemorrhagic Escherichia coli O157:H7 and genomic comparison with a laboratory strain K-12."Hayashi T., Makino K., Ohnishi M., Kurokawa K., Ishii K., Yokoyama K., Han C.-G., Ohtsubo E., Nakayama K., Murata T., Tanaka M., Tobe T., Iida T., Takami H., Honda T., Sasakawa C., Ogasawara N., Yasunaga T. Shinagawa H.DNA Res. 8:11-22(2001).
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Peptidyl-prolyl cis-trans isomerase A(ppiA)
- Regular price
- $1,139.00 USD
- Sale price
- $1,139.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli O6:H1 Peptidyl-prolyl cis-trans isomerase A(ppiA)
- Regular price
- $1,139.00 USD
- Sale price
- $1,139.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Peptidyl-prolyl cis-trans isomerase A(PPIA)
- Regular price
- $976.00 USD
- Sale price
- $976.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Peptidyl-prolyl cis-trans isomerase A-like 4A-B-C(PPIAL4A)
- Regular price
- $969.00 USD
- Sale price
- $969.00 USD
- Regular price
-
- Unit price
- per
Sold out