Skip to product information
1 of 1

Gene Bio Systems

Recombinant Penicillium chrysogenum Protein get1(get1)

Recombinant Penicillium chrysogenum Protein get1(get1)

SKU:CSB-CF478123ETH

Regular price $1,807.00 USD
Regular price Sale price $1,807.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255) (Penicillium notatum)

Uniprot NO.:B6HS10

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLSLVLTVFFVHVAIYLVNTIGASTIDSLLWLLYLKLPTPTSRTARKQQQLKRQVLEQKH EMNSTSSQDEFAKWAKARRRHDKSMEEYEALNKTLTAQKSSFDWTVKIARWLSTNGLKIF LQFWYSKTPVFPLPEAWFPYYVEWIVSFPRAPLGSVSIHVWSNVCATTIALTAEVMGALL VQIVGQKKEQRETAPVSAEGKKAQ

Protein Names:Recommended name: Protein get1 Alternative name(s): Guided entry of tail-anchored proteins 1

Gene Names:Name:get1 ORF Names:Pc22g17000

Expression Region:1-204

Sequence Info:full length protein

View full details