Skip to product information
1 of 1

Gene Bio Systems

Recombinant Penicillium chrysogenum Altered inheritance of mitochondria protein 31, mitochondrial(aim31)

Recombinant Penicillium chrysogenum Altered inheritance of mitochondria protein 31, mitochondrial(aim31)

SKU:CSB-CF471721ETH

Regular price $1,778.00 USD
Regular price Sale price $1,778.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255) (Penicillium notatum)

Uniprot NO.:B6H465

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSREPVPSSFDEGNPQFTEETGMQKFTRRLKEEPLVPLGCAATCYALYRAYRSMKSGDSV EMNRMFRARIYAQAFTLVALVAGGMYFKTERQQRREFDQAVELRKKQEKRDAWLRELEIR DKEDREWRERHAAIEAAAKEAGNKAAPRKEPEAARSSIEPADEKSIGVMDAVRALISRN

Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial

Gene Names:Name:aim31 ORF Names:Pc13g07740

Expression Region:1-179

Sequence Info:full length protein

View full details