Skip to product information
1 of 1

Gene Bio Systems

Recombinant Penaeus monodon Sarcoplasmic calcium binding protein

Recombinant Penaeus monodon Sarcoplasmic calcium binding protein

SKU:CSB-EP2035ETF

Regular price $1,242.00 USD
Regular price Sale price $1,242.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cardiovascular

Uniprot ID: E7CGC4

Gene Names: N/A

Organism: Penaeus monodon (Giant tiger prawn)

AA Sequence: MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQ

Expression Region: 1-193aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 38.1 kDa

Alternative Name(s):

Relevance:

Reference: "Cloning and expression of P. monodon allergic proteins and their molecular immunological characterization."Aravindan K., Santiago T.C., Kalaimani N., Alavandi S.V., Poornima M.Submitted (MAR-2010) to the EMBL/GenBank/DDBJ databases

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details