Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pea enation mosaic virus-1 Protein P1(ORF1)

Recombinant Pea enation mosaic virus-1 Protein P1(ORF1)

SKU:CSB-CF774577PDX

Regular price $1,827.00 USD
Regular price Sale price $1,827.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pea enation mosaic virus-1 (strain WSG) (PEMV-1)

Uniprot NO.:Q84710

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SYRTFIGSNKVALLSIRKLEEELSRGPIGLWADDTEDDESAPRRSGNGLFRSTPEKQSQA KTPSPKVEESAAPPPAPRAEKVRHVRRSEMTPEQKRADNLRRRKAKAAKKTPSTPPKKSK DKAPTLSQVAELVEKAVRAALTVQPRRSRASSKISIGGRNPGRKPQVSIQLDPVPSQSTS VPPKDSQAGESAWLGPRRSYRPVQKSTVGQKQEPRRN

Protein Names:Recommended name: Protein P1 Alternative name(s): Genome-linked protein precursor ORF1 protein Cleaved into the following 3 chains: 1. Serine protease EC= 2. 3.4.21.- 3. VPg 4. P1-C25

Gene Names:ORF Names:ORF1

Expression Region:544-760

Sequence Info:full length protein

View full details