Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pasteurella multocida Uncharacterized protein PM1478(PM1478)

Recombinant Pasteurella multocida Uncharacterized protein PM1478(PM1478)

SKU:CSB-CF875041ESG

Regular price $1,751.00 USD
Regular price Sale price $1,751.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pasteurella multocida (strain Pm70)

Uniprot NO.:Q9CKX3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKEFQFDTLWAVMQIMLGAFFWPALIVIILTIAAFCYLLIKEKGLVACRLKGSSLVGLLG GILALYLLFSISQASISDIGGPIDLILVVLAYFGGFLASTMLLYSIIGFVKPRSCACQKN

Protein Names:Recommended name: Uncharacterized protein PM1478

Gene Names:Ordered Locus Names:PM1478

Expression Region:1-120

Sequence Info:full length protein

View full details