Skip to product information
1 of 1

Gene Bio Systems

Recombinant Parvibaculum lavamentivorans ATP synthase subunit b 2(atpF2)

Recombinant Parvibaculum lavamentivorans ATP synthase subunit b 2(atpF2)

SKU:CSB-CF415571PYE

Regular price $1,786.00 USD
Regular price Sale price $1,786.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)

Uniprot NO.:A7HQY5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIAEAMAQEPGSELISETQVPDAEHAGGFPPFDAASFESQLVWLVLSFAALYLLMSRVAL PRIANVLEERRDRIADDLDQAAQFQLQTEEAIGAYEKALAEARAKAQGIAQETRDRLQEE TERQRLAIEARLAEKISEAEKQIAATKDAALQNVRAVAVDVADTIVAQLLGDSDRSATER AVDTELS

Protein Names:Recommended name: ATP synthase subunit b 2 Alternative name(s): ATP synthase F(0) sector subunit b 2 ATPase subunit I 2 F-type ATPase subunit b 2 Short name= F-ATPase subunit b 2

Gene Names:Name:atpF2 Ordered Locus Names:Plav_0695

Expression Region:1-187

Sequence Info:full length protein

View full details