Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Paracoccidioides brasiliensis (strain Pb18)
Uniprot NO.:Q52ZA1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GAKYRANLSKHPFLLFGLPFISVIIAGSFVLTPATAMRYERFDRKVQQVSQEEAMGLGLK GPEGDDGVQIKRNPRRRILGSEKEEYYKLMAKDLDNWEQKRVKRFKGEPDGRL
Protein Names:Recommended name: Cytochrome c oxidase assembly protein COX16, mitochondrial
Gene Names:Name:COX16 ORF Names:PADG_00294
Expression Region:23-135
Sequence Info:full length protein