Skip to product information
1 of 1

Gene Bio Systems

Recombinant Paracoccidioides brasiliensis Cytochrome c oxidase assembly protein COX16, mitochondrial(COX16)

Recombinant Paracoccidioides brasiliensis Cytochrome c oxidase assembly protein COX16, mitochondrial(COX16)

SKU:CSB-CF684442ERQ

Regular price $1,539.00 USD
Regular price Sale price $1,539.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Paracoccidioides brasiliensis (strain Pb18)

Uniprot NO.:Q52ZA1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GAKYRANLSKHPFLLFGLPFISVIIAGSFVLTPATAMRYERFDRKVQQVSQEEAMGLGLK GPEGDDGVQIKRNPRRRILGSEKEEYYKLMAKDLDNWEQKRVKRFKGEPDGRL

Protein Names:Recommended name: Cytochrome c oxidase assembly protein COX16, mitochondrial

Gene Names:Name:COX16 ORF Names:PADG_00294

Expression Region:23-135

Sequence Info:full length protein

View full details