Skip to product information
1 of 1

Gene Bio Systems

Recombinant Paracentrotus lividus ATP synthase subunit a(ATP6)

Recombinant Paracentrotus lividus ATP synthase subunit a(ATP6)

SKU:CSB-CF015070ERM

Regular price $1,842.00 USD
Regular price Sale price $1,842.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Paracentrotus lividus (Common sea urchin)

Uniprot NO.:P12696

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTMTITVSIFGQFFPETLLFIPMNLFSIVFALSWIAFIYPTNWAPSRFQSIWASFRANVL EMIFQNTSPNTAPWAGLITTVFIVILSANVLGLFPYAFTATSHISLTYSLGFPIWMAVNI LGFYLAFNSRLSHLVPQGTPSALIPLMVWIETLSLFAQPIALGLRLAANLTAGHLLIFLL STAIWLLSSSLMVSSIPIFVIFVLLFILEIGVACIEAYVFTALVHFYLQQNV

Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): F-ATPase protein 6

Gene Names:Name:ATP6

Expression Region:1-232

Sequence Info:full length protein

View full details