Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pantoea sp. L-alanine exporter AlaE(alaE)

Recombinant Pantoea sp. L-alanine exporter AlaE(alaE)

SKU:CSB-CF520489ERD

Regular price $1,765.00 USD
Regular price Sale price $1,765.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pantoea sp. (strain At-9b)

Uniprot NO.:E6WMH4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALSWQSLIDRITNLAKNQRQKKRGTEFLADTVALILFFTTTGIINERMIAGMSWDQVLH ARLIGAALMIPVARPYGIWRDWLMQRANPSRGSQLLWDSMALVSFQVPIYAAIIAFSGAT GGGLVRGTLGAALMMLFLGRPYGAFLNWVRKLFGLPPGGDKPMSLDS

Protein Names:Recommended name: L-alanine exporter AlaE

Gene Names:Name:alaE Ordered Locus Names:Pat9b_4640

Expression Region:1-167

Sequence Info:full length protein

View full details