Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pan troglodytes Sperm acrosome membrane-associated protein 3(SPACA3)

Recombinant Pan troglodytes Sperm acrosome membrane-associated protein 3(SPACA3)

SKU:CSB-CF022454EQV

Regular price $1,876.00 USD
Regular price Sale price $1,876.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pan troglodytes (Chimpanzee)

Uniprot NO.:B6VH76

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSALRRAPLIRVHSSPVSSPSVSGPQRLVSCLSSQSSALSQSGGGSTSAAGIEARSRALRRRWCPAGIMLLALVCLLSCLLPSSEAKLYGRCELARVLHDFGLDGYRGYSLADWVCLAYFTSGFNAAALDYEADGSTNNGIFQINSRRWCSNLTPNVPNVCQMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF

Protein Names:Recommended name: Sperm acrosome membrane-associated protein 3 Alternative name(s): Sperm protein reactive with antisperm antibodies Short name= Sperm protein reactive with ASA Cleaved into the following 2 chains: 1. Sperm acrosome membrane-associated protein 3, membrane form 2. Sperm acrosome membrane-associated protein 3, processed form

Gene Names:Name:SPACA3 Synonyms:SPRASA

Expression Region:1-215

Sequence Info:full length protein

View full details