![Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial(NDUFB11)](http://cdn.shopify.com/s/files/1/0558/8588/9636/products/no_image_default_image-jpeg_fedc46c1-fdee-4601-9124-c3285c44b32c_{width}x.jpg?v=1659246537)
![Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial(NDUFB11)](http://cdn.shopify.com/s/files/1/0558/8588/9636/products/no_image_default_image-jpeg_fedc46c1-fdee-4601-9124-c3285c44b32c_530x@2x.jpg?v=1659246537)
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pan troglodytes (Chimpanzee)
Uniprot NO.:Q0MQJ5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ESSFSRTVVAPSAVAGKRPPEPTTQWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRL VFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQL PEDE
Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial Alternative name(s): Complex I-ESSS Short name= CI-ESSS NADH-ubiquinone oxidoreductase ESSS subunit
Gene Names:Name:NDUFB11
Expression Region:30-153
Sequence Info:full length protein