Gene Bio Systems
Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11(NDUFA11)
Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11(NDUFA11)
SKU:CSB-CF609491EQV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pan troglodytes (Chimpanzee)
Uniprot NO.:Q0MQC0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:APKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTF TAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIA ASLVKMGRLEGWEVFAKPKV
Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 Alternative name(s): Complex I-B14.7 Short name= CI-B14.7 NADH-ubiquinone oxidoreductase subunit B14.7
Gene Names:Name:NDUFA11
Expression Region:2-141
Sequence Info:full length protein
![Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11(NDUFA11)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_2781a286-8a6c-4288-a5d4-4ea0be2c8bd7.jpg?v=1659245617&width=1445)