Skip to product information
1 of 1

Gene Bio Systems

Recombinant Paenibacillus macerans Cyclomaltodextrin glucanotransferase,partial

Recombinant Paenibacillus macerans Cyclomaltodextrin glucanotransferase,partial

SKU:CSB-YP327084EQJ

Regular price $1,364.00 USD
Regular price Sale price $1,364.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Microbiology

Uniprot ID: P31835

Gene Names: N/A

Organism: Bacillus macerans

AA Sequence: VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN

Expression Region: 608-713aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 13.4 kDa

Alternative Name(s): Cyclodextrin-glycosyltransferase Short name:CGTase

Relevance:

Reference: "Polypeptide possessing cyclomaltodextrin glucanotransferase activity."Sugimoto T., Kubota M., Sakai S.Patent number GB2169902, 23-JUL-1986

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details