Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica UPF0603 protein Os05g0401100, chloroplastic(Os05g0401100, LOC_Os05g33280)

Recombinant Oryza sativa subsp. japonica UPF0603 protein Os05g0401100, chloroplastic(Os05g0401100, LOC_Os05g33280)

SKU:CSB-CF738112OFG

Regular price $1,806.00 USD
Regular price Sale price $1,806.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q6ATY4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SEFDVLNGGPPEDTYVVDDAGVLSRVTKSDVKRLVRDLESRKNIRINFITVRKLTSKADA FEYADQVLEKWYPTVEEGNNKGIVVLVTSQKEGAITGGPAFVQAVGDEILDSTVSENLPV LATDEKYNEAIYTTAKRLAAAIDGLPDPGGPTFKDNKRESNFKTKEETEEKRGQFTLVVG GLLVIAFVVPMAQYYAYISKK

Protein Names:Recommended name: UPF0603 protein Os05g0401100, chloroplastic

Gene Names:Ordered Locus Names:Os05g0401100, LOC_Os05g33280 ORF Names:OSJNBa0035J16.9

Expression Region:99-299

Sequence Info:full length protein

View full details