Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 5(SCAMP5)

Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 5(SCAMP5)

SKU:CSB-CF765048OFG

Regular price $1,903.00 USD
Regular price Sale price $1,903.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q6Z8F5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHHDPNPFDEGADDNPFSNGGGGGARRGGGGGGGGGGGGGKSQFSFGFGGLGGGSKGGAT VDIPLDNMSDSKGKGKELLQWEADLKRREADIRRREEALKSAGVPMEEKNWPPFFPIIHH DIANEIPANAQKLQYLAFASWLGIVLCLFWNFIAVIVCWIRGGDSKLFFLATIYGMLGMP LSYLMWYRPLYRAMRTDSAFSFGWFFLCYMLHIAFCVFAAIAPPVIFRGKSLTGILAAID TFSDHAIVGIFYFVGFALFCLETLVSIWVLQKVYMYFRGHK

Protein Names:Recommended name: Secretory carrier-associated membrane protein 5 Short name= Secretory carrier membrane protein 5

Gene Names:Name:SCAMP5 Ordered Locus Names:Os02g0697800, LOC_Os02g47010 ORF Names:OsJ_007763, P0459B01.9

Expression Region:1-281

Sequence Info:full length protein

View full details