Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Protein transport protein Sec61 subunit gamma (Os02g0178400, LOC_Os02g08180)

Recombinant Oryza sativa subsp. japonica Protein transport protein Sec61 subunit gamma (Os02g0178400, LOC_Os02g08180)

SKU:CSB-CF020959OFG

Regular price $1,692.00 USD
Regular price Sale price $1,692.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:P38385

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDAVDSVVDPLREFAKDSVRLVKRCHKPDRKEFTKVAARTAIGFVVMGFVGFFVKLIFIPINNIIVGSG

Protein Names:Recommended name: Protein transport protein Sec61 subunit gamma

Gene Names:Ordered Locus Names:Os02g0178400, LOC_Os02g08180 ORF Names:P0544B02.4

Expression Region:1-69

Sequence Info:full length protein

View full details