Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Oleosin 16 kDa(OLE16)

Recombinant Oryza sativa subsp. japonica Oleosin 16 kDa(OLE16)

SKU:CSB-CF669261OFG

Regular price $1,740.00 USD
Regular price Sale price $1,740.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q42980

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ADQHRGVIGGGGYGDRGGQEQQEKQRFMMTALKTVTAATAGGSMLVLSGLILAGTVIALT VATPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLD HAKARLASKARDIKEAAQHRIDQAQAS

Protein Names:Recommended name: Oleosin 16 kDa Alternative name(s): OSE701

Gene Names:Name:OLE16 Synonyms:1CP, OSE375 Ordered Locus Names:Os04g0546500, LOC_Os04g46200 ORF Names:OSJNBa0079A21.14

Expression Region:2-148

Sequence Info:full length protein

View full details