Gene Bio Systems
Recombinant Oryza sativa subsp. japonica Cytochrome b6-f complex iron-sulfur subunit, chloroplastic(petC)
Recombinant Oryza sativa subsp. japonica Cytochrome b6-f complex iron-sulfur subunit, chloroplastic(petC)
SKU:CSB-CF734752OFG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:Q69S39
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AASSIPADRVPDMGKRQLMNLLLLGAISLPTVGMLVPYGAFFIPAGSGNAGGGQVAKDKL GNDVLAEEWLKTHGPNDRTLTQGLKGDPTYLVVEADKTLATYGINAVCTHLGCVVPWNAA ENKFICPCHGSQYNNQGRVVRGPAPLSLALVHADVDDGKVLFVPWVETDFRTGDNPWWA
Protein Names:Recommended name: Cytochrome b6-f complex iron-sulfur subunit, chloroplastic EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein Rieske iron-sulfur protein Short name= ISP Shor
Gene Names:Name:petC Ordered Locus Names:Os07g0556200, LOC_Os07g37030 ORF Names:OSJNBa0058I18.25
Expression Region:47-225
Sequence Info:full length protein
