Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Copper transporter 2(COPT2)

Recombinant Oryza sativa subsp. japonica Copper transporter 2(COPT2)

SKU:CSB-CF720216OFG

Regular price $1,742.00 USD
Regular price Sale price $1,742.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q60EN8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDMGGNGMAMPPPPAPVKKARYMHMTFFWGKNTEVLFTLWPGARGGMYALAILFMFALAV LLEFRGYRVLEARLARRRAPRAAAALRTAVHAVRVGVAYLIMLALMSFNGGVFLAIVAGH AAGFLAFRAGLCGGGPAPPLEEDRKNDPVCC

Protein Names:Recommended name: Copper transporter 2 Short name= OsCOPT2

Gene Names:Name:COPT2 Ordered Locus Names:Os05g0424700, LOC_Os05g35050 ORF Names:OJ1212_B02.11

Expression Region:1-151

Sequence Info:full length protein

View full details