Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica CASP-like protein Os05g0344400(Os05g0344400, LOC_Os05g27790)

Recombinant Oryza sativa subsp. japonica CASP-like protein Os05g0344400(Os05g0344400, LOC_Os05g27790)

SKU:CSB-CF722802OFG

Regular price $1,809.00 USD
Regular price Sale price $1,809.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q5W6M3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAAVAASSGAPAADVEKGAAAADANVDGGGAPAAAAASGEGVVSAVVRRWRRQDLLEKS GSALRVAAWAFSLLAFVVMGANDHGDWRQFEHYEEYRYVVAIGVLAFIYTTLQLVRHGVR LTGGQDLQGKVAVLVDFAGDQVTAYLLMSAVSAAIPITNRMREGADNVFTDSSAASISMA FFAFLCLALSALVSGFKLAKQTYI

Protein Names:Recommended name: CASP-like protein Os05g0344400

Gene Names:Ordered Locus Names:Os05g0344400, LOC_Os05g27790 ORF Names:B1036C05.1, P0015F11.14

Expression Region:1-204

Sequence Info:full length protein

View full details