Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica CASP-like protein Os04g0684300(Os04g0684300, LOC_Os04g58760)

Recombinant Oryza sativa subsp. japonica CASP-like protein Os04g0684300(Os04g0684300, LOC_Os04g58760)

SKU:CSB-CF773720OFG

Regular price $1,834.00 USD
Regular price Sale price $1,834.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q7XPU9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSGEPAAVSIPIHDHHGKAPATSSAVPAAAAAAPAAAPAVAPRKVGIPFFRRGDHHRGS RCLAFLDFILRIAAFGPALAAAISTGTSDETLSVFTEFYQFRARFDDFPAFLFFLVANAI VAGYLVLSLPFSAVLVIRPQTIGLRLLLLVCDMIMAAMLTAAASAAAAIVDLAHNGNLRA NWVAICMQFHGFCQRTSGSVVASFLTVVILMFLVILAACSIRKR

Protein Names:Recommended name: CASP-like protein Os04g0684300

Gene Names:Ordered Locus Names:Os04g0684300, LOC_Os04g58760 ORF Names:OsJ_015951, OSJNBa0088H09.7

Expression Region:1-224

Sequence Info:full length protein

View full details