Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica CASP-like protein Os04g0281900(Os04g0281900, LOC_Os04g21320)

Recombinant Oryza sativa subsp. japonica CASP-like protein Os04g0281900(Os04g0281900, LOC_Os04g21320)

SKU:CSB-CF611201OFG

Regular price $1,815.00 USD
Regular price Sale price $1,815.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q0JEF7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSKMAEEKVLAAPATVDGGMQSSGDLQASSAAAARVRPVETLLRAAPLGLCVAAMAIMLR NSVTNEYGTVSYSDLGGFKYLVYANGLCAAYSLASAFYIAVPRPATLSRSWVVFLLDQVF TYLILAAGAASAELLYLAYNGDKEVTWSEACGVFGGFCRQARTSVAITFASVACYILLSL ISSYRLFSAYDPPQPSLGNKGVEIAAFPR

Protein Names:Recommended name: CASP-like protein Os04g0281900

Gene Names:Ordered Locus Names:Os04g0281900, LOC_Os04g21320 ORF Names:OsJ_14118, OSJNBa0071G03.1, OSJNBa0094P09.18

Expression Region:1-209

Sequence Info:full length protein

View full details