Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Bidirectional sugar transporter SWEET7c(SWEET7C)

Recombinant Oryza sativa subsp. japonica Bidirectional sugar transporter SWEET7c(SWEET7C)

SKU:CSB-CF652425OFG

Regular price $1,916.00 USD
Regular price Sale price $1,916.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q2QWX8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSPDLIRNVVGIVGNVISFGLFLSPVPIFWRIIKNKNVQNFKADPILVVTINGISLVIE AVYLTIFFLFSDKKNKKKMGVVLATEALFMAAVAVGVLLGAHTHQRRSLIVGILCVIFGT IMYSSPLTIMVVKTKSVEYMPLLLSVVSFLNGLCWTLYALIRFDIFITIPNGLGVLFAIM QLILYAIYYRTTPKKQDKNLELPTVAPIAKDTSIVAPVSNDDDVNGSTASHATINITIEP

Protein Names:Recommended name: Bidirectional sugar transporter SWEET7c Short name= OsSWEET7c

Gene Names:Name:SWEET7C Ordered Locus Names:Os12g0178500, LOC_Os12g07860 ORF Names:OsJ_35418

Expression Region:1-240

Sequence Info:full length protein

View full details