Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Aquaporin PIP1-1(PIP1-1)

Recombinant Oryza sativa subsp. japonica Aquaporin PIP1-1(PIP1-1)

SKU:CSB-CF738633OFG

Regular price $1,914.00 USD
Regular price Sale price $1,914.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q6EU94

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEGKEEDVRLGANRYSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE FVATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV TFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGDG LGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA RSLGAAIIYNKDHAWNDHWIFWVGPFVGAALAAIYHQVIIRAIPFKSRS

Protein Names:Recommended name: Aquaporin PIP1-1 Alternative name(s): OsPIP1;1 Plasma membrane intrinsic protein 1-1 Plasma membrane intrinsic protein 1a Short name= PIP1a Water channel protein RWC1 Short name= RWC-1

Gene Names:Name:PIP1-1 Synonyms:PIP1A, RWC1 Ordered Locus Names:Os02g0666200, LOC_Os02g44630 ORF Names:OJ1486_E07.10, OsJ_007594, P0461B08.25

Expression Region:1-289

Sequence Info:full length protein

View full details