Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica 3-hydroxyacyl-CoA dehydratase PASTICCINO 2A(PAS2A)

Recombinant Oryza sativa subsp. japonica 3-hydroxyacyl-CoA dehydratase PASTICCINO 2A(PAS2A)

SKU:CSB-CF770284OFG

Regular price $1,898.00 USD
Regular price Sale price $1,898.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q7XSZ4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGVGSAVRRLYLSVYNWAVFFGWAQVLYYAVTTLLESGHEAVYAAVERPLQFAQTAAFL EILHGLVGLVRSPVSATLPQIGSRLFLTWGILWSFPETHSHILVTSLVISWSITEIIRYS FFGMKEAFGFAPSWLLWLRYSTFMVLYPTGISSEVGLIYIALPYMKASEKYCLRMPNKWN FSFDFFYASILSLAIYVPGSPHMFTYMLAQRKKALAKAKAA

Protein Names:Recommended name: 3-hydroxyacyl-CoA dehydratase PASTICCINO 2A Short name= HACD Short name= PAS2A EC= 4.2.1.- Alternative name(s): Protein tyrosine phosphatase-like protein

Gene Names:Name:PAS2A Ordered Locus Names:Os04g0271200, LOC_Os04g20280 ORF Names:OsJ_14083, OSJNBb0056F09.1, OSJNBb0067G11.14

Expression Region:1-221

Sequence Info:full length protein

View full details