Recombinant Oryza sativa subsp. indica  Defender against cell death 1(DAD1)

Recombinant Oryza sativa subsp. indica Defender against cell death 1(DAD1)

CSB-CF006487OFF
Regular price
$1,083.00 USD
Sale price
$1,083.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. indica (Rice)

Uniprot NO.:A2XSY1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPRATSDAKLLIQSLGKAYAATPTNLKIIDLYVVFAVATALIQVVYMGIVGSFPFNSFLS GVLSCIGTAVLAVCLRIQVNKDNKEFKDLPPERAFADFVLCNLVLHLVIMNFLG

Protein Names:Recommended name: Defender against cell death 1 Short name= DAD-1 Alternative name(s): Defender against apoptotic death 1 protein

Gene Names:Name:DAD1 Synonyms:DAD-1 ORF Names:OsI_015174

Expression Region:1-114

Sequence Info:full length protein