Recombinant Orycteropus afer  Aquaporin-2(AQP2)

Recombinant Orycteropus afer Aquaporin-2(AQP2)

CSB-CF001962OFC
Regular price
$1,083.00 USD
Sale price
$1,083.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Orycteropus afer (Aardvark)

Uniprot NO.:P79200

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SIAFSKAVFSEFLATLLFVFFGLGSALNWPQALPSGLQIAMAFGLAIGTLVQTLGHISGA HINPAVTVACLVGCHVSFLRAIFYVAAQLLGAVAGAALLHELTPPDIRG

Protein Names:Recommended name: Aquaporin-2 Short name= AQP-2 Alternative name(s): ADH water channel Aquaporin-CD Short name= AQP-CD Collecting duct water channel protein WCH-CD Water channel protein for renal collecting duct

Gene Names:Name:AQP2

Expression Region:1-109

Sequence Info:full length protein