Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ornithodoros moubata Tick anticoagulant peptide

Recombinant Ornithodoros moubata Tick anticoagulant peptide

SKU:CSB-EP325525OCK

Regular price $1,130.00 USD
Regular price Sale price $1,130.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P17726

Gene Names: N/A

Organism: Ornithodoros moubata (Soft tick) (Argasid tick)

AA Sequence: YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI

Expression Region: 1-60aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 27 kDa

Alternative Name(s):

Relevance: TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa.

Reference: "NMR solution structure of the recombinant tick anticoagulant protein (rTAP), a factor Xa inhibitor from the tick Ornithodoros moubata." Antuch W., Guntert P., Billeter M., Hawthorne T., Grossenbacher H., Wuethrich K. FEBS Lett. 352:251-257(1994)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details