Skip to product information
1 of 1

Gene Bio Systems

Recombinant Onion yellows phytoplasma Antigenic membrane protein(amp)

Recombinant Onion yellows phytoplasma Antigenic membrane protein(amp)

SKU:CSB-CF762587OBN

Regular price $1,804.00 USD
Regular price Sale price $1,804.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Onion yellows phytoplasma (strain OY-M)

Uniprot NO.:Q7M1T6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DDKLDLNTLECKDALELTAADAADAEKVVKQWKVQNTSLNAKVTKDSVKVAVADNKVTVT PADGDAGKALSGSKILNLVGVCELNKLTLGTEKKLTLTVKDGKVDAEAGLKALKEAGAKV PATVNKDDVTFTVGKDDNANKVTVKAVDGKTTVSGQVVFEFTVAKTPWYKTVWFLTLVAV VVVAAVAGGVFFFVKKNKKNK

Protein Names:Recommended name: Antigenic membrane protein Alternative name(s): Immunodominant membrane protein

Gene Names:Name:amp Ordered Locus Names:PAM_122

Expression Region:33-233

Sequence Info:full length protein

View full details