Gene Bio Systems
Recombinant Oligotropha carboxidovorans ATP synthase subunit b-b'(atpG)
Recombinant Oligotropha carboxidovorans ATP synthase subunit b-b'(atpG)
SKU:CSB-CF471926OED
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5)
Uniprot NO.:B6JDC8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAESHATGTTTHTEVPHGKPEFPPFNKDTFASQLVSFAIAFALLYVIVSRFALPRVGGVI KTREGTIEKDLAEAQAFRDESDLALKAYETELAAARTRAQAIGSETRDTLAAQSDAERKA VELSLSAKLAEAEKTISDMRTKAMGNVKAIAADATSAIVQQLSGTAPDAQLIDRAVDASL KGGRDAA
Protein Names:Recommended name: ATP synthase subunit b/b' Alternative name(s): ATP synthase F(0) sector subunit b/b' ATPase subunit II F-type ATPase subunit b/b' Short name= F-ATPase subunit b/b'
Gene Names:Name:atpG Ordered Locus Names:OCAR_4698, OCA5_c32520
Expression Region:1-187
Sequence Info:full length protein
