Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ochrobactrum anthropi Lectin-like protein BA14k (Oant_3884)

Recombinant Ochrobactrum anthropi Lectin-like protein BA14k (Oant_3884)

SKU:CSB-CF409708ODH

Regular price $1,749.00 USD
Regular price Sale price $1,749.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168)

Uniprot NO.:A6X5T5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:APLNLERPVINHNVEQVRDHRRPPRHYNGHRPHRPGYWNGHRGYRHYRHGYRRYNDGWWY PLAAFGAGAIIGGAVSQPRPVYRAPRMSNAHVQWCYNRYKSYRSSDNTFQPYNGPRRQCY SPYSR

Protein Names:Recommended name: Lectin-like protein BA14k

Gene Names:Ordered Locus Names:Oant_3884

Expression Region:27-151

Sequence Info:full length protein

View full details