Gene Bio Systems
Recombinant Ochrobactrum anthropi Lectin-like protein BA14k (Oant_3884)
Recombinant Ochrobactrum anthropi Lectin-like protein BA14k (Oant_3884)
SKU:CSB-CF409708ODH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168)
Uniprot NO.:A6X5T5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:APLNLERPVINHNVEQVRDHRRPPRHYNGHRPHRPGYWNGHRGYRHYRHGYRRYNDGWWY PLAAFGAGAIIGGAVSQPRPVYRAPRMSNAHVQWCYNRYKSYRSSDNTFQPYNGPRRQCY SPYSR
Protein Names:Recommended name: Lectin-like protein BA14k
Gene Names:Ordered Locus Names:Oant_3884
Expression Region:27-151
Sequence Info:full length protein
