Gene Bio Systems
Recombinant Oceanobacillus iheyensis Protein CrcB homolog(crcB)
Recombinant Oceanobacillus iheyensis Protein CrcB homolog(crcB)
SKU:CSB-CF811132OAB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)
Uniprot NO.:Q8EMX2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRNVLIVMLGGFIGANLRYWLGEWMSSSSGFPTGTFVINAIGCFLLGWLLTYSEKNRLLS KEWSLLLGTGLIGSFTTFSTFSVETLLLIESAKYIVASLYVFGSIFLGIGLAYIGVRLAL YCKKEEDIA
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:OB2718
Expression Region:1-129
Sequence Info:full length protein
