Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oceanobacillus iheyensis Large-conductance mechanosensitive channel(mscL)

Recombinant Oceanobacillus iheyensis Large-conductance mechanosensitive channel(mscL)

SKU:CSB-CF811980OAB

Regular price $1,716.00 USD
Regular price Sale price $1,716.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)

Uniprot NO.:Q8CUT6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWKEFKEFAFKGNIIDLAVAVVIGGAFGAIVTSFVENIITPLMGVIVGGVDFTTLKVTVG EAEILYGNFIQSFVDFIIIAFSIFLAIKFLVKFKRQKEEEEVEAVVEELSKQEELLTEIR DLLKEQSNKN

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:OB1021

Expression Region:1-130

Sequence Info:full length protein

View full details