Gene Bio Systems
Recombinant Nymphaea alba Photosystem II reaction center protein H(psbH)
Recombinant Nymphaea alba Photosystem II reaction center protein H(psbH)
SKU:CSB-CF728621NES
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nymphaea alba (White water-lily) (Castalia alba)
Uniprot NO.:Q6EW23
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ATQTIEGSSRSGPRRTIVGDLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIY NSSVLLDGISLS
Protein Names:Recommended name: Photosystem II reaction center protein H Short name= PSII-H Alternative name(s): Photosystem II 10 kDa phosphoprotein
Gene Names:Name:psbH
Expression Region:2-73
Sequence Info:full length protein
