Recombinant Nostoc sp.  Photosystem II reaction center protein Z(psbZ)

Recombinant Nostoc sp. Photosystem II reaction center protein Z(psbZ)

CSB-CF855862NHR
Regular price
$1,045.00 USD
Sale price
$1,045.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nostoc sp. (strain PCC 7120 / UTEX 2576)

Uniprot NO.:Q8YQ44

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTIIFQFALVALVLVSFVLVVGVPVAYATPQNWVESKKLLWLGSGVWIALVLLVGLLNFF VV

Protein Names:Recommended name: Photosystem II reaction center protein Z Short name= PSII-Z

Gene Names:Name:psbZ Ordered Locus Names:asr3992

Expression Region:1-62

Sequence Info:full length protein