Gene Bio Systems
Recombinant Nostoc sp. Photosystem I reaction center subunit PsaK 1(psaK1)
Recombinant Nostoc sp. Photosystem I reaction center subunit PsaK 1(psaK1)
SKU:CSB-CF349125NHR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nostoc sp. (strain PCC 7120 / UTEX 2576)
Uniprot NO.:P58583
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AATTPLEWSPTVGIIMVIANVIAITFGRQTIKYPSAEPALPSAKFFGGFGAPALLATTAF GHILGVGLVLGLHNLGRI
Protein Names:Recommended name: Photosystem I reaction center subunit PsaK 1 Alternative name(s): Photosystem I subunit X 1
Gene Names:Name:psaK1 Ordered Locus Names:asr4775
Expression Region:9-86
Sequence Info:full length protein
