Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nostoc sp. Alr2278 protein(alr2278)

Recombinant Nostoc sp. Alr2278 protein(alr2278)

SKU:CSB-BP2490FUZ

Regular price $769.00 USD
Regular price Sale price $769.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 25-35 working days

Research Topic: Others

Uniprot ID: Q8YUQ7

Gene Names: alr2278

Organism: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

AA Sequence: MYGLVNKAIQDMISKHHGEDTWEAIKQKAGLEDIDFFVGMEAYSDDVTYHLVGAASEVLGKPAEELLIAFGEYWVTYTSEEGYGELLASAGDSLPEFMENLDNLHARVGLSFPQLRPPAFECQHTSSKSMELHYQSTRCGLAPMVLGLLHGLGKRFQTKVEVTQTAFRETGEDHDIFSIKYEDSNLYDD

Expression Region: 1-189aa

Sequence Info: Full Length

Source: Baculovirus

Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-tagged

MW: 65.2 kDa

Alternative Name(s):

Relevance:

Reference: "NO and CO differentially activate soluble guanylyl cyclase via a heme pivot-bend mechanism." Ma X., Sayed N., Beuve A., van den Akker F. EMBO J. 26:578-588(2007)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details