Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nitrosomonas eutropha Disulfide bond formation protein B(dsbB)

Recombinant Nitrosomonas eutropha Disulfide bond formation protein B(dsbB)

SKU:CSB-CF601177NAAD

Regular price $1,798.00 USD
Regular price Sale price $1,798.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nitrosomonas eutropha (strain C91)

Uniprot NO.:Q0AFX4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRIIFLLIFLACAGLIGYALYLQLMDGLLPCPLCIFQRIAYWLIGITALFTFIHNPQSLG QHIYYGLIILFSLAGAIVAGRQAWLIRFPEAFECGISPEEAFLNGLPLAQWWPNMFEANG DCNDGTWQFLSLTLPDWSLLIFAAFGIIAGLLWHKKYNSINQ

Protein Names:Recommended name: Disulfide bond formation protein B Alternative name(s): Disulfide oxidoreductase

Gene Names:Name:dsbB Ordered Locus Names:Neut_1513

Expression Region:1-162

Sequence Info:full length protein

View full details