Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nitrosomonas europaea NADH-quinone oxidoreductase subunit A(nuoA)

Recombinant Nitrosomonas europaea NADH-quinone oxidoreductase subunit A(nuoA)

SKU:CSB-CF769248NHH

Regular price $1,738.00 USD
Regular price Sale price $1,738.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298)

Uniprot NO.:Q82TU3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLNTMLGNYFPILLFILVGLAIGVLSMLAGWLLAPNKPDAEKLSPYECGFGAFEDARMKF DVRYYLIAILFILFDLEIAFLFPWAVVLKEIGWFGFVAMLVFLGLLVVGFIYEWVKGALE WD

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1

Gene Names:Name:nuoA Ordered Locus Names:NE1777

Expression Region:1-122

Sequence Info:full length protein

View full details