Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nitrobacter hamburgensis Probable intracellular septation protein A(Nham_0403)

Recombinant Nitrobacter hamburgensis Probable intracellular septation protein A(Nham_0403)

SKU:CSB-CF637061NAAF

Regular price $1,873.00 USD
Regular price Sale price $1,873.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Nitrobacter hamburgensis (strain X14 / DSM 10229)

Uniprot NO.:Q1QR53

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDKKQPHPLFKLATELGPLLVFFAANAKFNLFVATAAFMVAIVAAMIASYVVTRHIPLMA LVTGIVVIVFGTLTLVLHDETFIKVKPTIIYSLFAGVLGGGLLFGRSFIAIMFDQVFNLT PRGWQVLTLRWALFFFGMAILNELIWRTQSTDFWVNFKVFGAVPLTMIFAMMQMPLTKRY HLEPATLEASDASEGDVRK

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Nham_0403

Expression Region:1-199

Sequence Info:full length protein

View full details