Gene Bio Systems
Recombinant Nicotiana tabacum Cytochrome b6-f complex iron-sulfur subunit 1, chloroplastic(petC1)
Recombinant Nicotiana tabacum Cytochrome b6-f complex iron-sulfur subunit 1, chloroplastic(petC1)
SKU:CSB-CF328981NHE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nicotiana tabacum (Common tobacco)
Uniprot NO.:P30361
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ATSIPADDRVPDMEKRNLMNLLLLGALSLPTAGMLVPYGTFFVPPGSGGGSGGTPAKDAL GNDVIASEWLKTHPPGNRTLTQGLKGDPTYLVVENDGTLATYGINAVCTHLGCVVPFNAA ENKFICPCHGSQYNNQGRVVRGPAPLSLALAHADIDDGKVVFVPWVETDFRTGEDPWWA
Protein Names:Recommended name: Cytochrome b6-f complex iron-sulfur subunit 1, chloroplastic EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1 Rieske iron-sulfur protein 1 Short name= ISP 1
Gene Names:Name:petC1 Synonyms:petC
Expression Region:50-228
Sequence Info:full length protein
