Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nicotiana plumbaginifolia Chlorophyll a-b binding protein E, chloroplastic(CABE)

Recombinant Nicotiana plumbaginifolia Chlorophyll a-b binding protein E, chloroplastic(CABE)

SKU:CSB-CF320975NHC

Regular price $1,845.00 USD
Regular price Sale price $1,845.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nicotiana plumbaginifolia (Leadwort-leaved tobacco) (Tex-Mex tobacco)

Uniprot NO.:P12470

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKE IKNGRLAMFSMFGFFVQALVTGKGPLENLADHLADPVNNNAWSYATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein E, chloroplastic Alternative name(s): LHCII type I CAB-E Short name= LHCP

Gene Names:Name:CABE

Expression Region:35-266

Sequence Info:full length protein

View full details