Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neurospora crassa ATP synthase subunit 9, mitochondrial(atp-9)

Recombinant Neurospora crassa ATP synthase subunit 9, mitochondrial(atp-9)

SKU:CSB-CF622501NHA

Regular price $1,499.00 USD
Regular price Sale price $1,499.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Uniprot NO.:Q12635

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIQVAKIIGTGLATTGLIGAGIGIGVVFGSLIIGVSRNPSLKSQLFAYAILGFAFSEATG LFALMMAFLLLYVA

Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein

Gene Names:Name:atp-9 ORF Names:NCU16027

Expression Region:1-74

Sequence Info:full length protein

View full details