Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neosartorya fumigata Vacuolar ATPase assembly integral membrane protein VMA21(vma21)

Recombinant Neosartorya fumigata Vacuolar ATPase assembly integral membrane protein VMA21(vma21)

SKU:CSB-CF025866NGT

Regular price $1,713.00 USD
Regular price Sale price $1,713.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)

Uniprot NO.:B0XYF0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTSRRSQEKSYAEAAAAPPPKESASSDVTPAVPADVIYKLLGFTAAMVVGPIGMYFVTVN SGGMSFFHQTSNFSLFETLTRIASPTVAGITAAITANLVLFGYIYVAWLDDREEREAASK RNEKKAQ

Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21

Gene Names:Name:vma21 ORF Names:AFUB_040680

Expression Region:1-127

Sequence Info:full length protein

View full details